Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using KDM6B/JMJD3 Rabbit pAb (A17382) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.
Immunohistochemistry analysis of paraffin-embedded Rat brain using KDM6B/JMJD3 Rabbit pAb (A17382) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil using KDM6B/JMJD3 Rabbit pAb (A17382) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
| Product name | KDM6B/JMJD3 Rabbit pAb |
|---|---|
| Catalog No. | A17382 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 90-190 of mouse KDM6B/JMJD3 (NP_001017426.1). |
|---|---|
| Sequence | LESLHGCVQALLREPAQPGLWEQLGQLYESEHDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLLHLEHKRNYGA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | JMJD3; NEDCFSA; KDM6B/JMJD3 |
| Calculated MW | 176kDa |
| Observed MW | 177kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | K562, HeLa, A-431, mouse liver |
| Cellular location | Nucleus. |
| Customer validation | WB(Mus musculus, Homo sapiens, Mus musculus) IHC(Homo sapiens) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A17382? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1718352560 "ABclonal:Western blot - KDM6B/JMJD3 Rabbit pAb (A17382)")
