Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KD Validated] ATG7 Rabbit mAb |
---|---|
Catalog No. | A19604 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0083 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Atg7(Apg7) (O95352). |
---|---|
Sequence | MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLPARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTAD |
Gene ID | |
Swiss Prot | |
Synonyms | GSA7; [KD Validated] ATG7 |
Calculated MW | 78kDa |
Observed MW | 77kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | HeLa, THP-1, 293T, Mouse brain, Mouse lung, Mouse spleen, Rat testis |
Cellular location | Cytoplasm, Preautophagosomal structure. |
Customer validation | IP(Homo sapiens) WB(Mus musculus, Homo sapiens, Rattus norvegicus) IF(Other) WB(Other) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19604? Please let us know so that we can cite the reference in this datasheet.