제품 > 항체 > 단일클론항체(mAb)

[KD Validated] HSP90B1 Rabbit mAb (A26311)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from wild type (WT) and HSP90B1 knockdown (KD) HeLa cells using [KD Validated] HSP90B1 Rabbit mAb (A26311) at 1:2000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

Western blot analysis of various lysates using [KD Validated] HSP90B1 Rabbit mAb (A26311) at 1:2000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - [KD Validated] HSP90B1 Rabbit mAb (A26311)

Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using [KD Validated] HSP90B1 Rabbit mAb (A26311) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver tissue using [KD Validated] HSP90B1 Rabbit mAb (A26311) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KD Validated] HSP90B1 Rabbit mAb (A26311) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KD Validated] HSP90B1 Rabbit mAb (A26311) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using [KD Validated] HSP90B1 Rabbit mAb (A26311) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using [KD Validated] HSP90B1 Rabbit mAb (A26311) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Overview

Product name	[KD Validated] HSP90B1 Rabbit mAb
Catalog No.	A26311
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60312

Background

This gene encodes a member of a family of adenosine triphosphate(ATP)-metabolizing molecular chaperones with roles in stabilizing and folding other proteins. The encoded protein is localized to melanosomes and the endoplasmic reticulum. Expression of this protein is associated with a variety of pathogenic states, including tumor formation. There is a microRNA gene located within the 5' exon of this gene. There are pseudogenes for this gene on chromosomes 1 and 15.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 616-715 of human HSP90B1 (NP_003290.1).
Sequence	EPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAV
Gene ID
Swiss Prot
Synonyms	ECGP; GP96; TRA1; GRP94; HEL35; HEL-S-125m
Calculated MW	92kDa
Observed MW	100kDa//100kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, MCF7, NIH/3T3, PC-12, HeLa, MCF7, NIH/3T3, PC-12
Cellular location	Endoplasmic reticulum lumen, Melanosome, cytosol, endoplasmic reticulum, endoplasmic reticulum lumen, extracellular exosome, extracellular region, focal adhesion, melanosome, nucleus, perinuclear region of cytoplasm, sperm plasma membrane.