제품 > 항체 > 다중클론항체(pAb)

[KD Validated] NF2 Rabbit pAb (A0739)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from wild type (WT) and NF2 knockdown (KD) HeLa cells using [KD Validated] NF2 Rabbit pAb (A0739) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 180 s.

Western blot analysis of various lysates using [KD Validated] NF2 Rabbit pAb (A0739) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 30 s.

ABclonal:Immunofluorescence - [KD Validated] NF2 Rabbit pAb (A0739)

Immunofluorescence analysis of C6 cells using [KD Validated] NF2 Rabbit pAb (A0739) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using [KD Validated] NF2 Rabbit pAb (A0739) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using [KD Validated] NF2 Rabbit pAb (A0739) at dilution of 1:100. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KD Validated] NF2 Rabbit pAb (A0739)

Immunoprecipitation analysis of 200 μg extracts of SKOV3 cells using 3 μg [KD Validated] NF2 Rabbit pAb (A0739). Western blot was performed from the immunoprecipitate using NF2 antibody (A0739) at a dilution of 1:1000.

Overview

Product name	[KD Validated] NF2 Rabbit pAb
Catalog No.	A0739
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that link cytoskeletal components with proteins in the cell membrane. The encoded protein is involved in regulation of contact-dependent inhibition of cell proliferation and functions in cell-cell adhesion and transmembrane signaling. The encoded protein has been shown to interact with cell-surface proteins, proteins involved in cytoskeletal dynamics, and proteins involved in regulating ion transport. Disruption of this protein's function has been implicated in tumorigenesis and metastasis. Mutations in this gene are associated with neurofibromatosis type II which is characterized by nervous system and skin tumors and ocular abnormalities.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 477-576 of human NF2 (NP_000259.1).
Sequence	TKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNT
Gene ID
Swiss Prot
Synonyms	ACN; SCH; BANF; merlin-1; F2
Calculated MW	70kDa
Observed MW	73kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	PC-3, Mouse brain, Mouse testis, PC-12, C6, HeLa
Cellular location	Cell projection, Cytoplasm, Cytoplasmic granule, Cytoplasmic side, Nucleus, Nucleus, Peripheral membrane protein, cytoskeleton, filopodium membrane, perinuclear region, ruffle membrane