제품 > 항체 > 단일클론항체(mAb)

[KD Validated] Sharpin Rabbit mAb (A24809)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of lysates from PC-3 cells, using [KD Validated] Sharpin Rabbit mAb (A24809) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from Rat thymus, using [KD Validated] Sharpin Rabbit mAb (A24809) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of lysates from wild type (WT) and Sharpin knockdown (KD) 293T cells, using [KD Validated] Sharpin Rabbit mAb (A24809) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - [KD Validated] Sharpin Rabbit mAb (A24809)

Confocal imaging of Jurkat cells using [KD Validated] Sharpin Rabbit mAb (A24809, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (blue). Objective: 100x.

Overview

Product name	[KD Validated] Sharpin Rabbit mAb
Catalog No.	A24809
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64384

Background

Enables polyubiquitin modification-dependent protein binding activity. Involved in protein linear polyubiquitination and regulation of signal transduction. Located in cytosol. Part of LUBAC complex.

Immunogen information

Immunogen	Recombinant Protein corresponding to a sequence within amino acids 1-126 of human SHARPIN(NP_112236.3).
Sequence	MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNG
Gene ID
Swiss Prot
Synonyms	SIPL1; [KD Validated] Sharpin
Calculated MW	40kDa
Observed MW	43kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IF/ICC 1:200 - 1:400 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, PC-3, Rat thymus
Cellular location	Cytoplasm.