제품 > 항체 > 단일클론항체(mAb)

KIF5B Rabbit mAb (A20928)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using KIF5B Rabbit mAb (A20928) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunofluorescence - KIF5B Rabbit mAb (A20928)

Confocal imaging of paraffin-embedded Human colon cancer tissue using KIF5B Rabbit mAb (A20928, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Overview

Product name	KIF5B Rabbit mAb
Catalog No.	A20928
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2904

Background

Enables identical protein binding activity; microtubule binding activity; and microtubule motor activity. Involved in several processes, including lysosome localization; natural killer cell mediated cytotoxicity; and positive regulation of protein localization to plasma membrane. Located in centriolar satellite; cytosol; and vesicle.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIF5B (NP_004512.1).
Sequence	MADLAECNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLH
Gene ID
Swiss Prot
Synonyms	KNS; KINH; KNS1; UKHC; HEL-S-61; KIF5B
Calculated MW	110kDa
Observed MW	120kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, HepG2, Mouse lung, Rat skeletal muscle, Mouse brain, Rat brain, Rat heart
Cellular location	Cytoplasm, Cytoskeleton
Customer validation	WB(Homo sapiens) IF(Homo sapiens)