제품 > 항체 > 다중클론항체(pAb)

[KO Validated] BRG1/SMARCA4 Rabbit pAb (A2117)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from wild type (WT) and BRG1/BRG1/SMARCA4 knockout (KO) 293T cells, using [KO Validated] BRG1/SMARCA4 Rabbit pAb (A2117) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 1s.

ABclonal:Immunohistochemistry - [KO Validated] BRG1/SMARCA4 Rabbit pAb (A2117)

Immunohistochemistry analysis of paraffin-embedded Human liver cancer using [KO Validated] BRG1/BRG1/SMARCA4 Rabbit pAb (A2117) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse lung using [KO Validated] BRG1/BRG1/SMARCA4 Rabbit pAb (A2117) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KO Validated] BRG1/SMARCA4 Rabbit pAb (A2117)

Immunofluorescence analysis of A549 cells using [KO Validated] BRG1/SMARCA4 Rabbit pAb (A2117). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KO Validated] BRG1/SMARCA4 Rabbit pAb (A2117)

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg BRG1/SMARCA4 antibody (A2117). Western blot was performed from the immunoprecipitate using BRG1/SMARCA4 antibody (A2117) at a dilution of 1:1000.

Overview

Product name	[KO Validated] BRG1/SMARCA4 Rabbit pAb
Catalog No.	A2117
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a member of the SWI/SNF family of proteins and is similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. In addition, this protein can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. Mutations in this gene cause rhabdoid tumor predisposition syndrome type 2. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 680-770 of human BRG1/SMARCA4 (NP_003063.2).
Sequence	PTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGVSQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYN
Gene ID
Swiss Prot
Synonyms	BRG1; CSS4; SNF2; SWI2; MRD16; RTPS2; BAF190; SNF2L4; SNF2LB; hSNF2b; BAF190A; SNF2-beta; A4
Calculated MW	185kDa
Observed MW	220kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	293T
Cellular location	Nucleus.