Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KO Validated] Claudin 1 Rabbit mAb |
---|---|
Catalog No. | A21971 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC54475 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 112-211 of human Claudin 1 (NP_066924.1). |
---|---|
Sequence | EVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV |
Gene ID | |
Swiss Prot | |
Synonyms | CLD1; SEMP1; ILVASC; 1 |
Calculated MW | 23kDa |
Observed MW | 20kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-431, Hep G2, Mouse liver, Mouse kidney, Rat kidney |
Cellular location | Cell junction, Cell membrane, Multi-pass membrane protein, tight junction. |
Customer validation | WB(Sus scrofa, Mus musculus, Anatinae, Coturnix japonica, Homo sapiens, Capra hircus, Rattus norvegicus) IHC(Mus musculus) IF(Sus scrofa, Mus musculus, Homo sapiens, Gallus gallus) WB(Mus musculus) IF(Mus musculus) IHC(Mus musculus) WB(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21971? Please let us know so that we can cite the reference in this datasheet.