Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KO Validated] Claudin 1 Rabbit mAb |
---|---|
Catalog No. | A21971 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC54475 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 112-211 of human Claudin 1 (NP_066924.1). |
---|---|
Sequence | EVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV |
Gene ID | |
Swiss Prot | |
Synonyms | CLD1; SEMP1; ILVASC; 1 |
Calculated MW | 23kDa |
Observed MW | 20kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-431, Hep G2, Mouse liver, Mouse kidney, Rat kidney |
Cellular location | Cell junction, Cell membrane, Multi-pass membrane protein, tight junction. |
Customer validation | WB(Sus scrofa, Mus musculus, Anatinae, Coturnix japonica, Homo sapiens, Capra hircus, Rattus norvegicus) IHC(Mus musculus) IF(Sus scrofa, Mus musculus, Homo sapiens) WB(Mus musculus) IF(Mus musculus) IHC(Mus musculus) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21971? Please let us know so that we can cite the reference in this datasheet.