Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | [KO Validated] Cyclin B1 Rabbit mAb |
---|---|
Catalog No. | A19037 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0474 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 3-177 of human Cyclin B1 (P14635). |
---|---|
Sequence | LRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAY |
Gene ID | |
Swiss Prot | |
Synonyms | CCNB; B1 |
Calculated MW | 48kDa |
Observed MW | 55kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, Jurkat |
Cellular location | Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center. |
Customer validation | WB(Homo sapiens, Mus musculus, Rattus norvegicus, Other) IHC(Homo sapiens, Mus musculus) IF(Homo sapiens, Mus musculus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19037? Please let us know so that we can cite the reference in this datasheet.