제품 > 항체 > 단일클론항체(mAb)

[KO Validated] Fatty Acid Synthase (FASN) Rabbit PolymAb® (A22462PM)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using [KO Validated] Fatty Acid Synthase (FASN) Rabbit PolymAb® (FASN) antibody (A22462PM) at 1:10000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from wild type(WT) and Fatty Acid Synthase (FASN) knockout (KO) HeLa cells, using [KO Validated] Fatty Acid Synthase (FASN) Rabbit PolymAb® (A22462PM) at 1:10000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - [KO Validated] Fatty Acid Synthase (FASN) Rabbit PolymAb® (A22462PM)

Immunofluorescence analysis of HeLa cells using [KO Validated] Fatty Acid Synthase (FASN) Rabbit PolymAb® (A22462PM) at dilution of 1:500 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HepG2 cells using [KO Validated] Fatty Acid Synthase (FASN) Rabbit PolymAb® (A22462PM) at dilution of 1:500 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Fatty Acid Synthase (FASN) Rabbit PolymAb® (A22462PM) at dilution of 1:500 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using [KO Validated] Fatty Acid Synthase (FASN) Rabbit PolymAb® (A22462PM) at dilution of 1:500 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	[KO Validated] Fatty Acid Synthase (FASN) Rabbit PolymAb®
Catalog No.	A22462PM
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 2212-2511 of human Fatty Acid Synthase (FASN) Rabbit PolymAb® (NP_004095.4).
Sequence	QQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG
Gene ID
Swiss Prot
Synonyms	FAS; OA-519; SDR27X1
Calculated MW	273kDa
Observed MW	273kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:10000 IF/ICC 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293F, NIH/3T3, Mouse liver, HeLa
Cellular location	Cytoplasm, Melanosome.