제품 > 항체 > 단일클론항체(mAb)

[KO Validated] HDAC8 Rabbit mAb (A8865)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using HDAC8 Rabbit mAb (A8865) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of lysates from wild type (WT) and HDAC8 knockout (KO) 293T cells, using [KO Validated] HDAC8 Rabbit mAb (A8865) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - [KO Validated] HDAC8 Rabbit mAb (A8865)

Immunohistochemistry analysis of paraffin-embedded Rat brain using HDAC8 Rabbit mAb (A8865) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KO Validated] HDAC8 Rabbit mAb (A8865)

Confocal imaging of HeLa cells using [KO Validated] HDAC8 Rabbit mAb (A8865, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Immunoprecipitation - [KO Validated] HDAC8 Rabbit mAb (A8865)

Immunoprecipitation analysis of 300 μg extracts from HeLa cells using 3 μg HDAC8 antibody (A8865). Western blot was performed from the immunoprecipitate using HDAC8 antibody (A8865) at a dilution of 1:1000.

Overview

Product name	[KO Validated] HDAC8 Rabbit mAb
Catalog No.	A8865
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1331

Background

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class I of the histone deacetylase family. It catalyzes the deacetylation of lysine residues in the histone N-terminal tails and represses transcription in large multiprotein complexes with transcriptional co-repressors. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC8 (Q9BY41).
Sequence	MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGY
Gene ID
Swiss Prot
Synonyms	HD8; WTS; RPD3; CDA07; CDLS5; KDAC8; MRXS6; HDACL1; C8
Calculated MW	42kDa
Observed MW	42kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IHC-P 1:100 - 1:1000 IF/ICC 1:100 - 1:1000 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	293T, HeLa, Raji, Mouse thymus, Rat brain, Rat thymus
Cellular location	Cytoplasm, Nucleus.
Customer validation	WB(Homo sapiens, Mus musculus, Rattus norvegicus, Other) IHC(Homo sapiens, Mus musculus, Rattus norvegicus)