Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KO Validated] HMGB1 Rabbit mAb |
---|---|
Catalog No. | A19529 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0001 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HMGB1 (P09429). |
---|---|
Sequence | SAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE |
Gene ID | |
Swiss Prot | |
Synonyms | HMG1; HMG3; HMG-1; SBP-1; B1 |
Calculated MW | 25kDa |
Observed MW | 25kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | 293F, HeLa, MCF7, Mouse brain, Mouse liver, Rat liver |
Cellular location | Cell membrane, Chromosome, Cytoplasm, Endoplasmic reticulum-Golgi intermediate compartment, Endosome, Extracellular side, Nucleus, Peripheral membrane protein, Secreted. |
Customer validation | IF(Rattus norvegicus, Mus musculus) IHC(Rattus norvegicus, Mus musculus , Homo sapiens) WB(Bos taurus, Mus musculus, Homo sapiens, Mus musculus) IHC(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19529? Please let us know so that we can cite the reference in this datasheet.