제품 > 항체 > 다중클론항체(pAb)

[KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Western blot analysis of lysates from wild type (WT) and HP1 gamma/HP1 gamma/CBX3 knockout (KO) 293T cells, using [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)

Immunofluorescence analysis of C6 cells using [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg HP1 gamma/CBX3 antibody (A2248). Western blot was performed from the immunoprecipitate using HP1 gamma/CBX3 antibody (A2248) at a dilution of 1:1000.

Overview

Product name	[KO Validated] HP1 gamma/CBX3 Rabbit pAb
Catalog No.	A2248
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of the encoded protein may explain the association of heterochromatin with the inner nuclear membrane. This protein binds histone H3 tails methylated at Lys-9 sites. This protein is also recruited to sites of ultraviolet-induced DNA damage and double-strand breaks. Two transcript variants encoding the same protein but differing in the 5' UTR, have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human HP1 gamma/HP1 gamma/CBX3 (NP_009207.2).
Sequence	MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ
Gene ID
Swiss Prot
Synonyms	HECH; HP1-GAMMA; HP1Hs-gamma; X3
Calculated MW	21kDa
Observed MW	23kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HeLa, MCF-7, 293T, A-549, NCI-H460, Mouse brain, Mouse lung, Mouse spleen
Cellular location	Nucleus.
Customer validation	IF(Rattus norvegicus) WB(Mus musculus, Rattus norvegicus) IHC(Mus musculus, Rattus norvegicus) IF(Rattus norvegicus)