Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from wild type (WT) and Histone H1.0 knockout (KO) 293T cells, using [KO Validated] Histone H1.0 Rabbit pAb (A3298) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human colon using [KO Validated] Histone H1.0 Rabbit pAb (A3298) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver cancer using [KO Validated] Histone H1.0 Rabbit pAb (A3298) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse liver using [KO Validated] Histone H1.0 Rabbit pAb (A3298) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Product name | [KO Validated] Histone H1.0 Rabbit pAb |
|---|---|
| Catalog No. | A3298 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human H1F0 (NP_005309.1). |
|---|---|
| Sequence | MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | H10; H1.0; H1F0; H1FV; .0 |
| Calculated MW | 21kDa |
| Observed MW | 30kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | 293T |
| Cellular location | Chromosome, Nucleus |
| Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3298? Please let us know so that we can cite the reference in this datasheet.
![ABclonal:Western blot - [KO Validated] Histone H1.0 Rabbit pAb (A3298)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3298_Q1079_KO-WB_01.jpg?t=1715050082 "ABclonal:Western blot - [KO Validated] Histone H1.0 Rabbit pAb (A3298)")
![ABclonal:Immunohistochemistry - [KO Validated] Histone H1.0 Rabbit pAb (A3298)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3298_Q1079_IHC_01.jpg?t=1715050082 "ABclonal:Immunohistochemistry - [KO Validated] Histone H1.0 Rabbit pAb (A3298)")
![ABclonal:Immunohistochemistry - [KO Validated] Histone H1.0 Rabbit pAb (A3298)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3298_Q1079_IHC_02.jpg?t=1715050082 "ABclonal:Immunohistochemistry - [KO Validated] Histone H1.0 Rabbit pAb (A3298)")
![ABclonal:Immunohistochemistry - [KO Validated] Histone H1.0 Rabbit pAb (A3298)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3298_Q1079_IHC_03.jpg?t=1715050082 "ABclonal:Immunohistochemistry - [KO Validated] Histone H1.0 Rabbit pAb (A3298)")
![ABclonal:Immunohistochemistry - [KO Validated] Histone H1.0 Rabbit pAb (A3298)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A3298_Q1079_IHC_04.jpg?t=1715050082 "ABclonal:Immunohistochemistry - [KO Validated] Histone H1.0 Rabbit pAb (A3298)")
