Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KO Validated] Histone H2A.Z Rabbit pAb |
---|---|
Catalog No. | A6614 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human H2AFZ (NP_002097.1). |
---|---|
Sequence | MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV |
Gene ID | |
Swiss Prot | |
Synonyms | H2AZ; H2A.z; H2A/z; H2AFZ; H2A.Z-1; .Z |
Calculated MW | 13kDa |
Observed MW | 15kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HL-60, MCF7, 22Rv1, PC-12, HepG2, Mouse testis, Mouse thymus, 293T |
Cellular location | Chromosome, Nucleus |
Customer validation | IHC(Homo sapiens) WB(Arabidopsis thaliana) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A6614? Please let us know so that we can cite the reference in this datasheet.