제품 > 항체 > 다중클론항체(pAb)

[KO Validated] IFITM3 Rabbit pAb (A13070)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from HeLa cells, using [KO Validated] IFITM3 Rabbit pAb (A13070) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of lysates from wild type (WT) and IFITM3 knockout (KO) HeLa cells, using [KO Validated] IFITM3 Rabbit pAb (A13070) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - [KO Validated] IFITM3 Rabbit pAb (A13070)

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using [KO Validated] IFITM3 Rabbit pAb (A13070) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KO Validated] IFITM3 Rabbit pAb (A13070)

Immunofluorescence analysis of C6 cells using [KO Validated] IFITM3 Rabbit pAb (A13070) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using [KO Validated] IFITM3 Rabbit pAb (A13070) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using [KO Validated] IFITM3 Rabbit pAb (A13070) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	[KO Validated] IFITM3 Rabbit pAb
Catalog No.	A13070
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 and belong to the CD225 superfamily. The protein encoded by this gene restricts cellular entry by diverse viral pathogens, such as influenza A virus, Ebola virus and Sars-CoV-2.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human IFITM3 (NP_066362.2).
Sequence	MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Gene ID
Swiss Prot
Synonyms	1-8U; IP15; DSPA2b; M3
Calculated MW	15kDa
Observed MW	15kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa
Cellular location	Cell membrane, Late endosome membrane, Lysosome membrane, Single-pass type II membrane protein
Customer validation	WB(Homo sapiens) IHC(Homo sapiens) WB(Homo sapiens)