Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Monkey
Product name | [KO Validated] NF-kB p65/RelA Rabbit mAb |
---|---|
Catalog No. | A22331 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC51088 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 450-551 of human NF-kB p65/RelA (NP_068810.3). |
---|---|
Sequence | LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS |
Gene ID | |
Swiss Prot | |
Synonyms | p65; CMCU; NFKB3; AIF3BL3; lA |
Calculated MW | 58kDa/59kDa/60kDa |
Observed MW | 65kDa/65KD |
Reactivity | Human, Mouse, Rat, Monkey |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | HeLa, PC-12, NIH/3T3, Mouse lung, HeLa |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | WB(Homo sapiens, Rattus norvegicus, Mus musculus) Co-IP(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22331? Please let us know so that we can cite the reference in this datasheet.