[KO Validated] Rig-I/DDX58 Rabbit pAb (A18003)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Overview

Product name	[KO Validated] Rig-I/DDX58 Rabbit pAb
Catalog No.	A18003
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. This gene encodes a protein containing RNA helicase-DEAD box protein motifs and a caspase recruitment domain (CARD). It is involved in viral double-stranded (ds) RNA recognition and the regulation of the antiviral innate immune response. Mutations in this gene are associated with Singleton-Merten syndrome 2.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 825-925 of human Rig-I/DDX58 (NP_055129.2).
Sequence	VIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK
Gene ID
Swiss Prot
Synonyms	RIG1; DDX58; RIG-I; RLR-1; SGMRT2; 58
Calculated MW	107kDa
Observed MW	102kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:20 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	A-549
Cellular location	Cell junction, Cell projection, Cytoplasm, cytoskeleton, ruffle membrane, tight junction.
Customer validation	WB(Mus musculus)