Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | [KO Validated] Rig-I/DDX58 Rabbit pAb |
---|---|
Catalog No. | A18003 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 825-925 of human Rig-I/DDX58 (NP_055129.2). |
---|---|
Sequence | VIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK |
Gene ID | |
Swiss Prot | |
Synonyms | RIG1; DDX58; RIG-I; RLR-1; SGMRT2; 58 |
Calculated MW | 107kDa |
Observed MW | 102kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | A-549 |
Cellular location | Cell junction, Cell projection, Cytoplasm, cytoskeleton, ruffle membrane, tight junction. |
Customer validation | WB(Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A18003? Please let us know so that we can cite the reference in this datasheet.