Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KO Validated] Smad3 Rabbit mAb |
---|---|
Catalog No. | A19115 |
Host species | Rabbit |
Purification method | Protein A |
Isotype | IgG |
CloneNo. | ARC53861 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Smad3 (NP_005893.1). |
---|---|
Sequence | HHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSM |
Gene ID | |
Swiss Prot | |
Synonyms | LDS3; mad3; LDS1C; MADH3; JV15-2; hMAD-3; hSMAD3; HSPC193; HsT17436; d3 |
Calculated MW | 48kDa |
Observed MW | 52kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | HCT116, A-549, C2C12, Rat testis |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | WB(Mus musculus, Rattus norvegicus, Homo sapiens) IHC(Homo sapiens, Mus musculus) IP(Homo sapiens) IF(Mus musculus ) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19115? Please let us know so that we can cite the reference in this datasheet.