Review (1)Publications (19) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | [KO Validated] c-Myc Rabbit mAb |
---|---|
Catalog No. | A19032 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0412 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human c-Myc (P01106). |
---|---|
Sequence | MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLE |
Gene ID | |
Swiss Prot | |
Synonyms | MRTL; MYCC; c-Myc; bHLHe39; yc |
Calculated MW | 51kDa |
Observed MW | 50-60kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Jurkat, MCF7, HCT 116 |
Cellular location | Nucleus, nucleolus, nucleoplasm. |
Customer validation | (293T MOLT4 IGROV-1) WB(Homo sapiens, Mus musculus, Cyprinus carpio, Mus musculus) IP(Homo sapiens) ChIP(Arabidopsis thaliana, Homo sapiens, Mus musculus) qPCR(Homo sapiens) Co-IP(Homo sapiens) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19032? Please let us know so that we can cite the reference in this datasheet.