Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates, using LC3A/LC3B Rabbit pAb (A5618) at 1:2000 dilution. 293T, NIH/3T3 and C6 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using LC3A/LC3B Rabbit pAb (A5618) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung cancer using LC3A/LC3B Rabbit pAb (A5618) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse testis using LC3A/LC3B Rabbit pAb (A5618) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain using LC3A/LC3B Rabbit pAb (A5618) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
| Product name | LC3A/LC3B Rabbit pAb |
|---|---|
| Catalog No. | A5618 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-60 of human LC3A (NP_115903.1). |
|---|---|
| Sequence | MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM |
| Gene ID | |
| Swiss Prot | |
| Synonyms | MAP1LC3B; ATG8F; LC3B; MAP1A/1BLC3; MAP1LC3B-a; MAP1LC3A; ATG8E; LC3; LC3A; MAP1ALC3; MAP1BLC3; LC3A/LC3B |
| Calculated MW | 14kDa |
| Observed MW | 14kDa/16kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | 293T treated by Chloroquine, NIH/3T3 treated by Chloroquine, C6 treated by Chloroquine |
| Cellular location | Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Lipid-anchor, autophagosome, autophagosome membrane, cytoskeleton. |
| Customer validation | WB(Gallus gallus, Rattus norvegicus, Homo sapiens, Mus musculus, Ctenopharyngodon idellus, Sus scrofa, Other, Horabagrus nigricollaris, Chlorocebus aethiops) IF(Gallus gallus, Mus musculus, Rattus norvegicus, Other) IHC(Sus scrofa) IF(Other, Mus musculus) IP(Homo sapiens,Mus musculus) WB(Homo sapiens,Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A5618? Please let us know so that we can cite the reference in this datasheet.
_WB_01.jpg?t=1718354025 "ABclonal:Western blot - LC3A/LC3B Rabbit pAb (A5618)")
(z)_IHC_01.jpg?t=1718354025 "ABclonal:Immunohistochemistry - LC3A/LC3B Rabbit pAb (A5618)")
(z)_IHC_02.jpg?t=1718354025 "ABclonal:Immunohistochemistry - LC3A/LC3B Rabbit pAb (A5618)")
(z)_IHC_03.jpg?t=1718354025 "ABclonal:Immunohistochemistry - LC3A/LC3B Rabbit pAb (A5618)")
(z)_IHC_04.jpg?t=1718354025 "ABclonal:Immunohistochemistry - LC3A/LC3B Rabbit pAb (A5618)")
(z)_IF_01.jpg?t=1718354025 "ABclonal:Immunofluorescence - LC3A/LC3B Rabbit pAb (A5618)")
