Review (1)Publications (14) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | LGR5/GPR49 Rabbit pAb |
---|---|
Catalog No. | A10545 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 824-907 of human LGR5/GPR49 (NP_003658.1). |
---|---|
Sequence | NPHFKEDLVSLRKQTYVWTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSSVAFVPCL |
Gene ID | |
Swiss Prot | |
Synonyms | FEX; HG38; GPR49; GPR67; GRP49; LGR5/GPR49 |
Calculated MW | 100kDa |
Observed MW | 100kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Mouse brain |
Cellular location | Cell membrane, Golgi apparatus, Multi-pass membrane protein, trans-Golgi network membrane. |
Customer validation | (Mouse heart tissue) WB(Homo sapiens, Mus musculus, Mus musculus, Sus scrofa) IHC(Rattus norvegicus) IF(Mus musculus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A10545? Please let us know so that we can cite the reference in this datasheet.