Reviews (2)Publications (15) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | LKB1 Rabbit pAb |
---|---|
Catalog No. | A2122 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 134-433 of human LKB1 (NP_000446.1). |
---|---|
Sequence | CGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSASSKIRRLSACKQQ |
Gene ID | |
Swiss Prot | |
Synonyms | PJS; LKB1; hLKB1 |
Calculated MW | 49kDa |
Observed MW | 49-60kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | MCF7, 293T, Mouse heart, Rat heart |
Cellular location | Cytoplasm, Membrane, Mitochondrion, Nucleus. |
Customer validation | (HeLa, Human,Mouse,Rat) WB(Homo sapiens, Mus musculus, Rattus norvegicus, Sus scrofa, Capra hircus) IF(Mus musculus) IHC(Mus musculus, Ctenopharyngodon idellus) PCR(Homo sapiens) WB(Ctenopharyngodon idellus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A2122? Please let us know so that we can cite the reference in this datasheet.