제품 > 항체 > 단일클론항체(mAb)

L-Plastin/LCP1 Rabbit mAb (A4664)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from Raji cells, using L-Plastin/LCP1 Rabbit mAb (A4664) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - L-Plastin/LCP1 Rabbit mAb (A4664)

Immunohistochemistry analysis of paraffin-embedded Human colon using L-Plastin/LCP1 Rabbit mAb (A4664) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded Human liver using L-Plastin/LCP1 Rabbit mAb (A4664) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	L-Plastin/LCP1 Rabbit mAb
Catalog No.	A4664
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2689

Background

Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 528-627 of human L-Plastin/LCP1 (P13796).
Sequence	TLREAKKSSSISSFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGKGMKRV
Gene ID
Swiss Prot
Synonyms	LPL; CP64; PLS2; LC64P; HEL-S-37; L-PLASTIN; L-Plastin/LCP1
Calculated MW	70kDa
Observed MW	70kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Raji
Cellular location	Actin cytoskeleton, Cytoplasm, Cytosol, Extracellular exosome, Extracellular space, Filopodium, Focal adhesion, Glial cell projection, Perinuclear region of cytoplasm, Phagocytic cup, Plasma membrane, podosome, Ruffle membrane