제품 > 항체 > 단일클론항체(mAb)

LYVE1 Rabbit mAb (A4352)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using LYVE1 Rabbit mAb (A4352) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	LYVE1 Rabbit mAb
Catalog No.	A4352
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0974

Background

This gene encodes a type I integral membrane glycoprotein. The encoded protein acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LYVE1 (Q9Y5Y7).
Sequence	MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRI
Gene ID
Swiss Prot
Synonyms	HAR; XLKD1; LYVE-1; CRSBP-1; LYVE1
Calculated MW	35kDa
Observed MW	33kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Jurkat, K-562, Mouse lung, Mouse brain, Rat lung, Rat uterus
Cellular location	Cell membrane, Single-pass type I membrane protein.
Customer validation	WB(Rattus norvegicus)