Review (1)Publications (22) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Western blot analysis of various lysates using Lipocalin-2/NGAL Rabbit pAb (A2092) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of Lipocalin-2/NGAL in paraffin-embedded human spleen tissue using Lipocalin-2/NGAL Rabbit pAb (A2092) at a dilution of 1:900 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of Lipocalin-2/NGAL in paraffin-embedded human lung tissue using Lipocalin-2/NGAL Rabbit pAb (A2092) at a dilution of 1:900 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of Lipocalin-2/NGAL in paraffin-embedded human esophagus tissue using Lipocalin-2/NGAL Rabbit pAb (A2092) at a dilution of 1:900 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded human spleen using Lipocalin-2/NGAL Rabbit pAb (A2092) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | Lipocalin-2/NGAL Rabbit pAb |
|---|---|
| Catalog No. | A2092 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 21-198 of human Lipocalin-2/NGAL (NP_005555.2). |
|---|---|
| Sequence | QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | p25; 24p3; MSFI; NGAL; Lipocalin-2/NGAL |
| Calculated MW | 23kDa |
| Observed MW | 20kDa |
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | U2OS, 293T negative |
| Cellular location | Secreted |
| Customer validation | (Mouse kidney) IF(Homo sapiens, Mus musculus) WB(Rattus norvegicus, Mus musculus, Homo sapiens) WB(Homo sapiens, Mus musculus) IF(Mus musculus) IHC(Mus musculus) IHC(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A2092? Please let us know so that we can cite the reference in this datasheet.
