제품 > 항체 > 단일클론항체(mAb)

Lipoprotein lipase (LPL) Rabbit mAb (A4115)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from Human plasma, using Lipoprotein lipase (LPL) (LPL) Rabbit mAb (A4115) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Western blot analysis of lysates from Mouse liver, using Lipoprotein lipase (LPL) (LPL) Rabbit mAb (A4115) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Overview

Product name	Lipoprotein lipase (LPL) Rabbit mAb
Catalog No.	A4115
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0904

Background

LPL encodes lipoprotein lipase, which is expressed in heart, muscle, and adipose tissue. LPL functions as a homodimer, and has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. Severe mutations that cause LPL deficiency result in type I hyperlipoproteinemia, while less extreme mutations in LPL are linked to many disorders of lipoprotein metabolism.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 376-475 of human Lipoprotein lipase (LPL) (P06858).
Sequence	IPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDWWSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
Gene ID
Swiss Prot
Synonyms	LIPD; HDLCQ11; Lipoprotein lipase (LPL)
Calculated MW	53kDa
Observed MW	53kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Human plasma, Mouse liver
Cellular location	Cell membrane, GPI-anchor, Lipid-anchor, Secreted.
Customer validation	WB(Mus musculus, Scylla)