제품 > 항체 > 다중클론항체(pAb)

MBL2 Rabbit pAb (A5825)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of lysates from Mouse serum, using MBL2 Rabbit pAb (A5825) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - MBL2 Rabbit pAb (A5825)

Immunohistochemistry analysis of paraffin-embedded Human liver using MBL2 Rabbit pAb (A5825) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol

Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using MBL2 Rabbit pAb (A5825) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol

Immunohistochemistry analysis of paraffin-embedded Human gastric carcinoma using MBL2 Rabbit pAb (A5825) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol

Immunohistochemistry analysis of paraffin-embedded Human colorectal cancer using MBL2 Rabbit pAb (A5825) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol

Overview

Product name	MBL2 Rabbit pAb
Catalog No.	A5825
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes and binds to mannose and N-acetylglucosamine on many microorganisms, including bacteria, yeast, and viruses including influenza virus, HIV and SARS-CoV. This binding activates the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 21-248 of human MBL2 (NP_000233.1).
Sequence	ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
Gene ID
Swiss Prot
Synonyms	MBL; MBP; MBP1; MBPD; MBL2D; MBP-C; COLEC1; HSMBPC; MBL2
Calculated MW	26kDa
Observed MW	26kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:100 - 1:500 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	Mouse serum
Cellular location	Secreted