Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using MMP14/MMP14/MT1-MMP Rabbit mAb (A0067) at 1：1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of various lysates using MMP14/MMP14/MT1-MMP Rabbit mAb (A0067) at 1：1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded Human liver tissue using MMP14/MT1-MMP Rabbit mAb (A0067) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using MMP14/MT1-MMP Rabbit mAb (A0067) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using MMP14/MT1-MMP Rabbit mAb (A0067) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Flow cytometry: 1X10^6 MCF7 cells (negative control, left) and HT-1080 (right) cells were intracellularly-stained with MMP14/MT1-MMP Rabbit mAb (A0067, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 488 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry: 1X10^6 MCF7 cells (negative control, left) and HT-1080 (right) cells were intracellularly-stained with MMP14/MT1-MMP Rabbit mAb (A0067, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 488 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry: 1X10^6 MCF7 cells (negative control, left) and HT-1080 (right) cells were intracellularly-stained with MMP14/MT1-MMP Rabbit mAb (A0067, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry: 1X10^6 MCF7 cells (negative control, left) and HT-1080 (right) cells were intracellularly-stained with MMP14/MT1-MMP Rabbit mAb (A0067, 2 μg/mL, orange line) or ABflo® 647 Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
| Product name | MMP14/MT1-MMP Rabbit mAb |
|---|---|
| Catalog No. | A0067 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0211 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MMP14/MMP14/MT1-MMP (P50281). |
|---|---|
| Sequence | GAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | MMP-14; MMP-X1; MT-MMP; MT1MMP; MTMMP1; WNCHRS; MT1-MMP; MT-MMP 1; MMP14/MT1-MMP |
| Calculated MW | 66kDa |
| Observed MW | 52kDa/60kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Flow Cytometry |
| Positive samples | HeLa, HepG2, Mouse lung, Mouse kidney, Mouse heart, Rat heart |
| Cellular location | Cytoplasm, Melanosome, Membrane, Single-pass type I membrane protein. |
| Customer validation | WB(Oryctolagus cuniculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0067? Please let us know so that we can cite the reference in this datasheet.
