Review (1)Publications (18) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | MMP3 Rabbit pAb |
---|---|
Catalog No. | A1202 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 385-477 of human MMP3 (NP_002413.1). |
---|---|
Sequence | VRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC |
Gene ID | |
Swiss Prot | |
Synonyms | SL-1; STMY; STR1; CHDS6; MMP-3; STMY1; MMP3 |
Calculated MW | 54kDa |
Observed MW | 60kDa/47kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Raji, Mouse heart, Rat liver |
Cellular location | Secreted, extracellular matrix, extracellular space. |
Customer validation | (MB-231) WB(Homo sapiens, Rattus norvegicus, Mus musculus) IHC(Rattus norvegicus, Homo sapiens) IF(Mus musculus ) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A1202? Please let us know so that we can cite the reference in this datasheet.