Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | MRP1/ABCC1 Rabbit pAb |
---|---|
Catalog No. | A3027 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 850-960 of human MRP1/ABCC1 (NP_004987.2). |
---|---|
Sequence | GSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKL |
Gene ID | |
Swiss Prot | |
Synonyms | MRP; ABCC; GS-X; MRP1; ABC29; DFNA77; MRP1/ABCC1 |
Calculated MW | 172kDa |
Observed MW | 170-220kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | A-549, Mouse brain, Rat brain |
Cellular location | Cell membrane, Multi-pass membrane protein |
Customer validation | WB(Streptomyces sp. FJS31-2, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3027? Please let us know so that we can cite the reference in this datasheet.