Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Mitofusin-1/MFN1 Rabbit mAb |
---|---|
Catalog No. | A21293 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC54223 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 642-741 of human Mitofusin-1/MFN1 (NP_284941.2). |
---|---|
Sequence | FKQQFVNYATEKLRMIVSSTSANCSHQVKQQIATTFARLCQQVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQFLPSSNEES |
Gene ID | |
Swiss Prot | |
Synonyms | hfzo1; hfzo2; Mitofusin-1/MFN1 |
Calculated MW | 84kDa |
Observed MW | 84kDa/ |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Mouse brain, T-47D, HeLa, A-431 |
Cellular location | Cytoplasm, Mitochondrion outer membrane, Multi-pass membrane protein. |
Customer validation | WB(Homo sapiens, Mus musculus, Rattus norvegicus, Fathead minnow, Gallus gallus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A21293? Please let us know so that we can cite the reference in this datasheet.