제품 > 항체 > 다중클론항체(pAb)

Monoamine Oxidase B (MAOB) Rabbit pAb (A1568)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from HeLa cells, using Monoamine Oxidase B (MAOB) Rabbit pAb (A1568) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - Monoamine Oxidase B (MAOB) Rabbit pAb (A1568)

Immunohistochemistry analysis of paraffin-embedded rat liver using Monoamine Oxidase B (MAOB) Rabbit pAb (A1568) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat heart using Monoamine Oxidase B (MAOB) Rabbit pAb (A1568) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human liver using Monoamine Oxidase B (MAOB) Rabbit pAb (A1568) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human liver cancer using Monoamine Oxidase B (MAOB) Rabbit pAb (A1568) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human colon using Monoamine Oxidase B (MAOB) Rabbit pAb (A1568) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Monoamine Oxidase B (MAOB) Rabbit pAb (A1568)

Immunofluorescence analysis of L929 cells using Monoamine Oxidase B (Monoamine Oxidase B (MAOB)) Rabbit pAb (A1568) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using Monoamine Oxidase B (Monoamine Oxidase B (MAOB)) Rabbit pAb (A1568) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using Monoamine Oxidase B (MAOB) Rabbit pAb (A1568) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Monoamine Oxidase B (MAOB) Rabbit pAb
Catalog No.	A1568
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 400-490 of human Monoamine Oxidase B (MAOB) (NP_000889.3).
Sequence	TYFPPGILTQYGRVLRQPVDRIYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVP
Gene ID
Swiss Prot
Synonyms	MAOB; Monoamine Oxidase B (MAOB)
Calculated MW	59kDa
Observed MW	60kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa
Cellular location	Cytoplasmic side, Mitochondrion outer membrane, Single-pass type IV membrane protein