Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | Myeloperoxidase (MPO) Rabbit pAb |
---|---|
Catalog No. | A1374 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 606-745 of human Myeloperoxidase (MPO) (NP_000241.1). |
---|---|
Sequence | CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS |
Gene ID | |
Swiss Prot | |
Synonyms | MPO; Myeloperoxidase (MPO) |
Calculated MW | 84kDa |
Observed MW | 60kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Immunofluorescence |
Positive samples | |
Cellular location | Lysosome. |
Customer validation | WB(Cyprinus carpio, Mus musculus, Rattus norvegicus, Homo sapiens) IF(Mus musculus, Gallus gallus, Rattus norvegicus, Homo sapiens) IHC(Mus musculus, Mus musculus ) FC(Saccharomyces cerevisiae) IHC(Rattus norvegicus) IF(Rattus norvegicus) Other(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A1374? Please let us know so that we can cite the reference in this datasheet.