Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | NADPH oxidase 4 (NOX4) Rabbit mAb |
---|---|
Catalog No. | A22149 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC55045 |
Immunogen | Recombinant protein of human NADPH oxidase 4 (NOX4) |
---|---|
Sequence | LHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS |
Gene ID | |
Swiss Prot | |
Synonyms | KOX; KOX-1; RENOX; NADPH oxidase 4 (NOX4) |
Calculated MW | 67KDa |
Observed MW | 62kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HK-2, HUVEC |
Cellular location | Cell junction, Cell membrane, Endoplasmic reticulum membrane, Multi-pass membrane protein, Nucleus, focal adhesion, nucleolus. |
Customer validation | WB(Homo sapiens, Mus musculus) IHC(Mus musculus, Homo sapiens) IF(Mus musculus) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22149? Please let us know so that we can cite the reference in this datasheet.