제품 > 항체 > 다중클론항체(pAb)

NAGA Rabbit pAb (A9942)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using NAGA antibody (A9942) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - NAGA Rabbit pAb (A9942)

Immunofluorescence analysis of L929 cells using NAGA Rabbit pAb (A9942) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	NAGA Rabbit pAb
Catalog No.	A9942
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

NAGA encodes the lysosomal enzyme alpha-N-acetylgalactosaminidase, which cleaves alpha-N-acetylgalactosaminyl moieties from glycoconjugates. Mutations in NAGA have been identified as the cause of Schindler disease types I and II (type II also known as Kanzaki disease).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 312-411 of human NAGA (NP_000253.1).
Sequence	IQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQ
Gene ID
Swiss Prot
Synonyms	GALB; D22S674
Calculated MW	47kDa
Observed MW	46kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HL-60, Mouse liver, Mouse kidney, Mouse lung, Rat testis
Cellular location	Lysosome