Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from Mouse heart using N-Cadherin Rabbit pAb (A3045) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:30s.
Immunohistochemistry analysis of paraffin-embedded Human liver tissue using N-Cadherin Rabbit pAb (A3045) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat heart tissue using N-Cadherin Rabbit pAb (A3045) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using N-Cadherin Rabbit pAb (A3045) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using N-Cadherin Rabbit pAb (A3045) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded rat heart using N-Cadherin Rabbit pAb (A3045). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | N-Cadherin Rabbit pAb |
|---|---|
| Catalog No. | A3045 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 488-587 of human N-Cadherin (NP_001783.2). |
|---|---|
| Sequence | VIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CDHN; NCAD; ACOGS; ADHD8; CD325; ARVD14; CDw325; N-Cadherin |
| Calculated MW | 100kDa |
| Observed MW | 80kDa/135kDa/130kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HeLa, A-549, 293T, Mouse liver, Mouse brain, Mouse heart, Rat liver, Rat heart, Mouse heart |
| Cellular location | Cell membrane, Single-pass type I membrane protein. |
| Customer validation | WB(Homo sapiens, Mus musculus, Mus musculus, Bos taurus) IHC(Homo sapiens) IF(Homo sapiens) IF(Homo sapiens, Oryctolagus cuniculus) WB(Oryctolagus cuniculus, Homo sapiens, Mus musculus) ELISA(Homo sapiens,Mus musculus,Oryctolagus cuniculus) IF(Homo sapiens,Mus musculus,Oryctolagus cuniculus) IHC(Homo sapiens,Mus musculus,Oryctolagus cuniculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3045? Please let us know so that we can cite the reference in this datasheet.
![[KO Validated] N-Cadherin Rabbit mAb](https://img.abclonal.com/abclonal-manage/Catalog/A19083/A19083_1.jpg?t=1730360772)
