Review (1)Publications (18) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | NF-kB p65/RelA Rabbit pAb |
---|---|
Catalog No. | A11204 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 450-551 of human NF-kB p65/RelA (NP_068810.3). |
---|---|
Sequence | LGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS |
Gene ID | |
Swiss Prot | |
Synonyms | p65; CMCU; NFKB3; AIF3BL3; NF-kB p65/RelA |
Calculated MW | 60kDa |
Observed MW | 65kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | 293T |
Cellular location | Cytoplasm, Nucleus |
Customer validation | (C57BL6) IF(Homo sapiens, Mus musculus) WB(Homo sapiens, Mus musculus, Sus scrofa, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A11204? Please let us know so that we can cite the reference in this datasheet.