Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | NLRP6 Rabbit pAb |
---|---|
Catalog No. | A15628 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-110 of human NLRP6 (NP_612202.2). |
---|---|
Sequence | MDQPEAPCSSTGPRLAVARELLLAALEELSQEQLKRFRHKLRDVGPDGRSIPWGRLERADAVDLAEQLAQFYGPEPALEVARKTLKRADARDVAAQLQERRLQRLGLGSG |
Gene ID | |
Swiss Prot | |
Synonyms | AVR; NAVR; PAN3; NALP6; PYPAF5; CLR11.4; NAVR/AVR |
Calculated MW | 99kDa |
Observed MW | 102kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse large intestine, Rat thymus |
Cellular location | cytoplasm, cytosol, inflammasome complex, NLRP6 inflammasome complex, nuclear membrane, plasma membrane |
Customer validation | WB(Mus musculus, Homo sapiens, Rattus norvegicus) IF(Homo sapiens, Mus musculus) IHC(Homo sapiens) ELISA(Homo sapiens,Mus musculus) IP(Homo sapiens,Mus musculus) IP(Homo sapiens,Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A15628? Please let us know so that we can cite the reference in this datasheet.