Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Monkey
Product name | NUP98 Rabbit mAb |
---|---|
Catalog No. | A22743 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC58955 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 712-863 of human NUP98. (NP_001352055.1). |
---|---|
Sequence | DESLQDDREEIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGDVNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSPDRLADINYEGRLEAVSRKQGAQF |
Gene ID | |
Swiss Prot | |
Synonyms | ADIR2; NUP96; NUP196; Nup98-96; NUP98 |
Calculated MW | 198kDa |
Observed MW | 98kDa/ |
Reactivity | Human, Mouse, Monkey |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HeLa, COS-7, Mouse testis, NIH/3T3 |
Cellular location | Nucleoplasmic side, Nucleus, Nucleus membrane, Peripheral membrane protein, nuclear pore complex. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.