Reviews (2)Publications (27) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | OCT4 Rabbit pAb |
---|---|
Catalog No. | A7920 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 210-310 of human 4-oct (NP_002692.2). |
---|---|
Sequence | EADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPV |
Gene ID | |
Swiss Prot | |
Synonyms | OCT3; OCT4; OTF3; OTF4; OTF-3; Oct-3; Oct-4; Oct3/4 |
Calculated MW | 39kDa |
Observed MW | 45kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | Mouse embryo |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | (HeLa cells) WB(Homo sapiens, Mus musculus) IHC(Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A7920? Please let us know so that we can cite the reference in this datasheet.