Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | ORP150/GRP170/HSP12A Rabbit mAb |
---|---|
Catalog No. | A1042 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC1857 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human ORP150/GRP170/HSP12A (Q9Y4L1). |
---|---|
Sequence | MADKVRRQRPRRRVCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVIVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISSQLQFSPEEVL |
Gene ID | |
Swiss Prot | |
Synonyms | IMD59; Grp170; HSP12A; ORP150; GRP-170; ORP-150; ORP150/GRP170/HSP12A |
Calculated MW | 111kDa |
Observed MW | 150kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa, Hep G2, BxPC-3, Mouse testis, Rat testis |
Cellular location | Endoplasmic reticulum lumen |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.