Review (1)Publications (35) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Osteocalcin (BGLAP) Rabbit pAb |
---|---|
Catalog No. | A6205 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Osteocalcin (BGLAP) (NP_954642.1). |
---|---|
Sequence | MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV |
Gene ID | |
Swiss Prot | |
Synonyms | OC; BGP; OCN; Osteocalcin (BGLAP) |
Calculated MW | 11kDa |
Observed MW | 12kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | U-87MG, Rat lung |
Cellular location | Secreted. |
Customer validation | (Mouse intervertebral disc) WB(Mus musculus, Rattus norvegicus, Homo sapiens, Gallus gallus, Oryctolagus cuniculus) IHC(Mus musculus, Homo sapiens, Mus musculus, Rattus norvegicus) IF(Homo sapiens, Mus musculus) IHC(Homo sapiens) RT-qPCR(Rattus norvegicus) WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A6205? Please let us know so that we can cite the reference in this datasheet.