Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PBEF/Visfatin/NAMPT Rabbit pAb |
---|---|
Catalog No. | A0256 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 181-382 of human PBEF/Visfatin/NAMPT (NP_005737.1). |
---|---|
Sequence | GNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGLALIKKYYGTKDPVPGYSVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQKMWSIENIAFGS |
Gene ID | |
Swiss Prot | |
Synonyms | VF; PBEF; PBEF1; VISFATIN; 1110035O14Rik; PBEF/Visfatin/NAMPT |
Calculated MW | 56kDa |
Observed MW | 56kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HT-1080, NIH/3T3, PC-12 |
Cellular location | Cytoplasm, Nucleus, Secreted. |
Customer validation | WB(Homo sapiens,Rattus norvegicus, Mus musculus, Gallus gallus) IHC(Sus scrofa) IHC(Mus musculus, Homo sapiens) IF(Rattus norvegicus, Homo sapiens) IF(Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A0256? Please let us know so that we can cite the reference in this datasheet.