제품 > 항체 > 단일클론항체(mAb)

PDIA6 Rabbit mAb (A4260)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using PDIA6 Rabbit mAb (A4260) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Western blot analysis of extracts of Mouse liver, using PDIA6 Rabbit mAb (A4260) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 3min.

ABclonal:Immunofluorescence - PDIA6 Rabbit mAb (A4260)

Confocal imaging of HeLa cells using PDIA6 Rabbit mAb (A4260, dilution 1:100) (Green). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC039, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.

Overview

Product name	PDIA6 Rabbit mAb
Catalog No.	A4260
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0944

Background

This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, two catalytically active thioredoxin (TRX) domains, a TRX-like domain, and a C-terminal ER-retention sequence. This protein inhibits the aggregation of misfolded proteins and exhibits both isomerase and chaperone activity. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PDIA6 (NP_005733.1).
Sequence	MALLVLGLVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPT
Gene ID
Swiss Prot
Synonyms	P5; ERP5; TXNDC7
Calculated MW	48kDa
Observed MW	50kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, Hep G2, Mouse liver, Rat liver
Cellular location	Cell membrane, Endoplasmic reticulum lumen, Melanosome