Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with PE Rabbit anti-Human CD336/NK-p44 mAb (A27276, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD336/NK-p44 mAb (A27276, 5 μl/Test, right).
Flow cytometry: 1X10^6 Human PBMC (treated with rhIL-2) were surface-stained with APC Mouse anti-Human CD56 mAb (A26869, 5 μl/Test) and PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD336/NK-p44 mAb (A27276, 5 μl/Test, right). Cells in the lymphocyte gate were used for analysis.
Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with PE Rabbit anti-Human CD336/NK-p44 mAb (A27276, 5 μl/Test, orange line) or PE Rabbit IgG isotype control (A24172, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human CD336/NK-p44 mAb (A27276, 5 μl/Test, right).
| Product name | PE Rabbit anti-Human CD336/NK-p44 mAb |
|---|---|
| Catalog No. | A27276 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC69299-PE |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-190 of human CD336/NK-p44 (NP_004819.2). |
|---|---|
| Sequence | QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAP |
| Gene ID | |
| Swiss Prot | |
| Synonyms | LY95; CD336; NKP44; NK-p44; dJ149M18.1 |
| Calculated MW | 31kDa |
| Observed MW |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3. |
| Key application | Flow Cytometry |
| Positive samples | |
| Cellular location | Cell membrane, Single-pass type I membrane protein. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
