제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Mouse CD366 (TIM-3) mAb (A25729)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Flow cytometry: 1X10^6 NIH/3T3 cells (Low Expression, left) and RAW 264.7 cells (right) were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by PE Donkey anti-Rabbit pAb staining or PE Rabbit anti-Mouse CD366 (TIM-3) mAb (A25729, 5 μl/Test, orange line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 RAW 264.7 cells were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left), followed by PE Donkey anti-Rabbit pAb staining or PE Rabbit anti-Mouse CD366 (TIM-3) mAb (A25729, 5 μl/Test, right).

Overview

Product name	PE Rabbit anti-Mouse CD366 (TIM-3) mAb
Catalog No.	A25729
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC59425-PE

Background

Predicted to enable metal ion binding activity. Involved in several processes, including regulation of cytokine production; regulation of leukocyte activation; and toll-like receptor signaling pathway. Located in cell surface; early endosome; and immunological synapse. Is expressed in several structures, including dorsal aorta; gut; liver; lung; and reproductive system. Human ortholog(s) of this gene implicated in hepatocellular carcinoma and renal cell carcinoma. Orthologous to human HAVCR2 (hepatitis A virus cellular receptor 2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-191 of mouse CD366 (TIM-3) (NP_599011.2)
Sequence	RSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR
Gene ID
Swiss Prot
Synonyms	Tim3; TIM-3; Timd3
Calculated MW	22kDa/31kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Plasma membrane, Cell junction, Secreted