Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | PGC1α/β Rabbit mAb |
---|---|
Catalog No. | A19674 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0153 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 699-798 of human PGC1α/β (NP_037393.1). |
---|---|
Sequence | VFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR |
Gene ID | |
Swiss Prot | |
Synonyms | LEM6; PGC-1(alpha); PGC-1alpha; PGC-1v; PGC1; PGC1A; PPARGC1; ERRL1; PERC; PGC-1(beta); PGC1B; PGC1α/β |
Calculated MW | 113kDa |
Observed MW | 113kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Mouse liver, Rat heart |
Cellular location | cytoplasm, nucleoplasm, nucleus, PML body. |
Customer validation | WB(Homo sapiens, Rattus norvegicus, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19674? Please let us know so that we can cite the reference in this datasheet.