Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | PGC1α Rabbit pAb |
---|---|
Catalog No. | A11971 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 610-710 of human PGC1α (NP_037393.1). |
---|---|
Sequence | HRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESERAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNL |
Gene ID | |
Swiss Prot | |
Synonyms | LEM6; PGC1; PGC1A; PGC-1v; PPARGC1; PGC-1alpha; PGC-1(alpha); PGC1α |
Calculated MW | 91kDa |
Observed MW | 91kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse kidney, Mouse heart, Rat heart |
Cellular location | Cytoplasm, Nucleus, PML body. |
Customer validation | WB(Mus musculus, Rattus norvegicus, Ctenopharyngodon idellus, Homo sapiens, Mus musculus, Gallus gallus) IF(Mus musculus, Rattus norvegicus) WB(Rattus norvegicus) IHC(Mus musculus) IF(Mus musculus, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11971? Please let us know so that we can cite the reference in this datasheet.