제품 > 항체 > 단일클론항체(mAb)

PGE receptor EP2 (PTGER2) Rabbit mAb (A9053)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using PGE Receptor EP2 (PGE Receptor EP2 (PGE receptor EP2 (PTGER2))) Rabbit mAb (A9053) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - PGE receptor EP2 (PTGER2) Rabbit mAb (A9053)

Immunohistochemistry analysis of paraffin-embedded Human placenta using PGE Receptor EP2 (PGE Receptor EP2 (PGE receptor EP2 (PTGER2))) Rabbit mAb (A9053) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - PGE receptor EP2 (PTGER2) Rabbit mAb (A9053)

Immunofluorescence analysis of C6 cells using PGE Receptor EP2 (PGE Receptor EP2 (PGE receptor EP2 (PTGER2))) Rabbit mAb (A9053) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using PGE Receptor EP2 (PGE Receptor EP2 (PGE receptor EP2 (PTGER2))) Rabbit mAb (A9053) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using PGE Receptor EP2 (PGE Receptor EP2 (PGE receptor EP2 (PTGER2))) Rabbit mAb (A9053) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	PGE receptor EP2 (PTGER2) Rabbit mAb
Catalog No.	A9053
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1393

Background

This gene encodes a receptor for prostaglandin E2, a metabolite of arachidonic acid which has different biologic activities in a wide range of tissues. Mutations in this gene are associated with aspirin-induced susceptibility to asthma.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 259-358 of human PGE receptor EP2 (PTGER2) (P43116).
Sequence	ETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
Gene ID
Swiss Prot
Synonyms	EP2; PGE receptor EP2 (PTGER2)
Calculated MW	40kDa
Observed MW	52kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:100 - 1:1000 IF/ICC 1:100 - 1:400 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, A-549, THP-1, Mouse lung, Mouse liver, Mouse spleen, Rat testis
Cellular location	plasma membrane.
Customer validation	IF(Mus musculus)